PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008226456.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NZZ/SPL
Protein Properties Length: 447aa    MW: 48759.2 Da    PI: 7.9114
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008226456.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE22.61.8e-07288050102
          NOZZLE  50 ktaqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssvaaisntatrl 102
                      + + kqkk   rg+gva+le+ ++e+++kk ++a +  t s  +++ ++t  
  XP_008226456.1  28 SSKKTKQKKVPQRGLGVAQLEKIRLEDQQKKAAAAVILSTPSSLSSPTKSTSS 80 
                     45567899999*************************99999999998888765 PP

Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MAQEDQTQKC SNTSSGASLG FASITRSSSK KTKQKKVPQR GLGVAQLEKI RLEDQQKKAA  60
AAVILSTPSS LSSPTKSTSS SCPSVPIRHF YHSNHNQPPS SIPFPSLPSL DLPSPNSIFR  120
PPLIPTQNID VIRKPISTVP WGNNNNNNGG HGFEIQGHGN NNVPNLWNPC DFNLDQKESS  180
NSGIDPGLAF RSTLNLPFES NNPIWPLTNV PQRTQPYHQQ PPPPPSMVNV SSTTSSSSVL  240
NFQIEPPSNQ SYYSNCTPMW PDEEKMVGMK RPYPFSLDNP PGPSINFKFP TFVAPMRADE  300
ASSCGNRCTY NLEPSGNPIF REAPSCSTSI SESNSRNSIK ENGSVNGDFL TLAPPTTSSR  360
TCPSPKLNLP STYLAFHNRE VPEFESFSYQ GNAEDTNFQP GPSCSHPQQA FYSFFPPAKA  420
QIGRAVTTIN NNCNGELGES VDLNLKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008226456.10.0PREDICTED: rho GTPase-activating protein gacII-like
TrEMBLM5WHS40.0M5WHS4_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s38460.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89561213